Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0195-10 | 7 days | 10 µg | $110.00 |
Select product before adding to cart
|
||
| VAG0195-50 | 7 days | 50 µg | $290.00 | |||
| VAG0195-1 | 7 days | 1 mg | $3,256.00 |
Product Overview | |
| Name | HBsAg preS1 |
|---|---|
| Description | |
| Hepatitis B Surface Antigen, preS1 Recombinant | |
| Introduction | |
| Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2. | |
| Source | |
| E.coli. | |
| Formulation | |
| HBsAg protein was lyophilized from 0.2 µm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. | |
| Stability | |
| This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Amino acid sequence | |
| MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN. | |
| Solubility | |
| We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. | |
| Precautions | |
| HBsAg preS1 is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
