Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0351-100 | 7 days | 100 µg | $150.00 |
Select product before adding to cart
|
||
| VAG0351-500 | 7 days | 500 µg | $600.00 | |||
| VAG0351-1000 | 7 days | 1000 µg | $800.00 |
Product Overview | |
| Name | HIV-2 gp36 |
|---|---|
| Description | |
| Synthetic HIV-2 gp36 | |
| Introduction | |
| HIV-1 and HIV-2 appear to package their RNA differently. HIV-1 binds to any appropriate RNA whereas HIV-2 preferentially binds to mRNA which creates the Gag protein itself. This means that HIV-1 is better able to mutate. HIV-2 is transmitted in the same ways as HIV-1: Through exposure to bodily fluids such as blood, semen, tears and vaginal fluids. Immunodeficiency develops more slowly with HIV-2. HIV-2 is less infectious in the early stages of the virus than with HIV-1. The infectiousness of HIV-2 increases as the virus progresses. Major differences include reduced pathogenicity of HIV-2 relative to HIV-1, enhanced immune control of HIV-2 infection and often some degree of CD4-independence. Despite considerable sequence and phenotypic differences between HIV-1 and 2 envelopes, structurally they are quite similar. Both membrane-anchored proteins eventually form the 6-helix bundles from the N-terminal and C-terminal regions of the ectodomain, which is common to many viral and cellular fusion proteins and which seems to drive fusion. HIV-1 gp41 helical regions can form more stable 6-helix bundles than HIV-2 gp41 helical regions however HIV-2 fusion occurs at a lower threshold temperature (25°C), does not require Ca2+ in the medium, is insensitive to treatment of target cells with cytochalasin B, and is not affected by target membrane glycosphingolipid composition. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile filtered colorless clear solution. | |
| Formulation | |
| 0.01M Na 2 CO 3 , 0.01M Na 3 EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20. | |
| Stability | |
| HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by HPLC analysis and SDS-PAGE. | |
| Amino acid sequence | |
| EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCH IKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQ NNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEK RYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQS RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVT AIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDN MTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNS WDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQML SRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGG SNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC. | |
| Specificity | |
| Reactive with human HIV positive serum. | |
| Precautions | |
| HIV-2 gp36 is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
