Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0364-100 | 7 days | 100 µg | $330.00 |
Select product before adding to cart
|
||
| VAG0364-500 | 7 days | 500 µg | $1,320.00 | |||
| VAG0364-1000 | 7 days | 1000 µg | $1,760.00 |
Product Overview | |
| Name | HSV-1 gG |
|---|---|
| Description | |
| Herpes Simplex Virus-1 gG Recombinant | |
| Introduction | |
| Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell. | |
| Source | |
| Escherichia Coli. | |
| Physical Appearance | |
| Sterile Filtered clear solution. | |
| Formulation | |
| 10mM Phosphate buffer pH 7.6 and 75mM NaCl. | |
| Stability | |
| HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Protein is >90% pure as determined by SDS PAGE. | |
| Amino acid sequence | |
| MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGT TVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGF YARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCT HHHHHH . | |
| Applications | |
| ELISA, WB, Flow-Through. | |
| Precautions | |
| HSV-1 gG is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
