Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0378-100 | 7 days | 100 µg | $330.00 |
Select product before adding to cart
|
||
| VAG0378-500 | 7 days | 500 µg | $1,320.00 | |||
| VAG0378-1000 | 7 days | 1000 µg | $1,760.00 |
Product Overview | |
| Name | HTLV-1 p24 core |
|---|---|
| Description | |
| HTLV-1 p24 Core Recombinant | |
| Synonyms | |
| HTNV, Hantaan Virus, Hantanvirus. | |
| Introduction | |
| Hantaviruses is part of the Bunyaviridae family of viruses. Hantaviruses are transmitted by aerosolized rodent excretia or rodent bites. The infection of Hantavirus is called hemorrhagic fever with renal syndrome (HFRS) relating with high mortality, and several other Hantaviruses are associated with the etiologic agents causing Hantavirus pulmonary syndrome (HPS) or Hantavirus cardiopulmonary syndrome (HCPS). Hantavirus infection increases vascular permeability and decreases blood pressure due to endothelial dysfunction, the most dramatic damage is seen in the kidneys, while lung, spleen, and gall bladder are most affected. Regions affected by HFRS include China, the Korean Peninsula, Russia, and northern and western Europe. Regions with the highest incidences of HPS or HCPS include Argentina, Chile, Brazil, the United States, Canada, and Panama. The agent causing HCPS in South America is Andes virus, one member of Hantavirus, which causes a person-to-person transmission, fatality rate, was reported about 25-35% in Argentina and of 37% in Chile. | |
| Source | |
| E.Coli | |
| Physical Appearance | |
| Sterile filtered colorless solution. | |
| Formulation | |
| HTNV is formulated in 1xPBS pH-7.4 and 0.05% Sodium azide. | |
| Stability | |
| Upon arrival, Store at -20°C. Please avoid multiple freeze/thaw cycles. | |
| Purity | |
| HTNV protein is >95% pure as determined by 12% PAGE (coomassie staining). | |
| Amino acid sequence | |
| GSMATMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDRE GVAVSIQAKIDELKRQLADRIATGKNLGKEQDPTGVEPGDHLKERSMLSY GNVLDLNHLDIDEPTGQTADWLSIVVYVD | |
| Purification Method | |
| Purified by proprietary chromatographic technique. | |
| Precautions | |
| HTLV-1 p24 core is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
