Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0500-100 | 7 days | 100 µg | $330.00 |
Select product before adding to cart
|
||
| VAG0500-500 | 7 days | 500 µg | $1,320.00 | |||
| VAG0500-1000 | 7 days | 1000 µg | $2,160.00 |
Product Overview | |
| Name | WNV Envelope |
|---|---|
| Description | |
| West Nile Virus Envelope Recombinant | |
| Introduction | |
| West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins. | |
| Source | |
| Escherichia Coli. | |
| Formulation | |
| 20mM phosphate buffer pH 7.5. | |
| Stability | |
| WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. | |
| Purity | |
| Protein is >95% pure as determined by SDS-PAGE. | |
| Amino acid sequence | |
| MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK ATRYLVKTESWILRNPGYALE. | |
| Applications | |
| Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems. | |
| Purification Method | |
| Purified by proprietary chromatographic technique. | |
| Specificity | |
| Immunoreactive with sera of West Nile virus infected individuals. | |
| Precautions | |
| WNV Envelope is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
