Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List |
|---|
Product Overview | |
| Name | SIV GAG |
|---|---|
| Description | |
| Simian Immunodeficiency Virus Recombinant | |
| Accession (Primary) | NP046122 |
| Synonyms | |
| CD352, KALI, KALIb, Ly108, NTB-A, NTBA, Activating NK receptor, SLAM family member 6. | |
| Introduction | |
| SLAM family member 6 (SLAMF6) is a member of the SLAM family of immune cell receptors. SLAMF6 is a unique receptor on T cells which, when triggered potentiates T cell expansion in a CD28-independent manner. SLAMF6 has a high expression on NK-, T-, and B cells. SLAMF6 exhibits homotypic interactions and can connect with adaptor molecules such as SAP to alter immune cell function. | |
| Source | |
| HEK 293 cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| Lyophilized from a (0.2 µM) filtered solution containing 20mM PB and 150mM NaCl, pH 7.2. | |
| Stability | |
| Lyophilized SLAMF6 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SLAMF6 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| LMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQG KRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHS QLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQD YTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKVDHHHHHH. | |
| Solubility | |
| It is recommended to reconstitute the lyophilized SLAMF6 in sterile 1xPBS not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | |
| Precautions | |
| SIV GAG is for research use only and not for use in diagnostic or therapeutic procedures. | |
Target Information: ( NP046122 ) | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
