Hello, Sign in
My Account
My Account
New customer? Start here
| Catalog # | Availability | Size | Quantity | Unit Price | Save For Later Wish List | |
|---|---|---|---|---|---|---|
| VAG0549-2 | 7 days | 2 µg | $100.00 |
Select product before adding to cart
|
||
| VAG0549-10 | 7 days | 10 µg | $400.00 | |||
| VAG0549-100 | 7 days | 100 µg | $2,880.00 |
Product Overview | |
| Name | Wisconsin 01/2010 Recombinant |
|---|---|
| Description | |
| Influenza B- Virus Wisconsin 01/2010 Recombinant | |
| Synonyms | |
| WNT1 Inducible Signaling Pathway Protein 1, CCN Family Member 4, CCN4, Wnt-1 Inducible, Signaling Pathway Protein 1, WNT1 Induced Secreted Protein 1, Wnt-1-Induced Secreted Protein, CTC-458A3.8, WISP1tc, WISP1c, WISP1i, WISP-1, WISP1. | |
| Introduction | |
| WISP1 is a part of a family of cysteine-rich, glycosylated signaling proteins that mediate varied developmental processes. WISP1 is a Downstream regulator in the Wnt/Frizzled-signaling pathway and is linked with cell survival.WISP1weakens p53-mediated apoptosis in response to DNA damage through activation of AKT kinase and up-regulates the anti-apoptotic Bcl-X(L) protein. | |
| Source | |
| HEK293 Cells. | |
| Physical Appearance | |
| Sterile Filtered White lyophilized (freeze-dried) powder. | |
| Formulation | |
| WISP1 protein was lyophilized from a 0.2 µm filtered solution in PBS. | |
| Stability | |
| Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles . Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. | |
| Purity | |
| Greater than 95.0% as determined by SDS-PAGE. | |
| Amino acid sequence | |
| TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRG LYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRR VSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCW PEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQC PDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFSEIAN HHHHHHHHHH . | |
| Solubility | |
| It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/ml and let the lyophilized pellet dissolve completely. | |
| Precautions | |
| Wisconsin 01/2010 Recombinant is for research use only and not for use in diagnostic or therapeutic procedures. | |
Thousands of laboratories across the world have published research that depended on the performance of antibodies from ADMEbio to advance their research.
Check out links to articles that cite our products in major peer-reviewed journals, organized by research category.
Thank you,
ADMEbio Team
ADMEbio welcomes feedback from our customers.
Thank you,
ADMEbio Team
